SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340624483|ref|YP_004742936.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340624483|ref|YP_004742936.1|
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily GlnB-like 5.19e-26
Family Divalent ion tolerance proteins CutA (CutA1) 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340624483|ref|YP_004742936.1|
Sequence length 104
Comment CutA1 divalent ion tolerance protein [Methanococcus maripaludis X1]
Sequence
MEKPTLVYTTFPNFETAKSIVGYLLEKKMIACANLREHEAHYFNDGDLSINTEIGAFLKT
TENRWISLKDMINEIHPLETPAILKINIDDSNDEFKNWILNIIK
Download sequence
Identical sequences G0H136 Q6LY30
WP_011171107.1.40991 WP_011171107.1.41672 gi|340624483|ref|YP_004742936.1| 267377.MMP1163 gi|45358726|ref|NP_988283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]