SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780595|ref|YP_006545068.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780595|ref|YP_006545068.1|
Domain Number 1 Region: 240-579
Classification Level Classification E-value
Superfamily SIS domain 2.32e-88
Family double-SIS domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 2-219
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.92e-66
Family Class II glutamine amidotransferases 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780595|ref|YP_006545068.1|
Sequence length 579
Comment glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [Methanoculleus bourgensis MS2]
Sequence
MCGIVGYIGRREATPVLIQGLKRLEYRGYDSFGIATVGSALEVYKKTGRISDGEAGAASL
RGSTGIGHTRWATHGEPNDINAHPHMDCRGRIAVVHNGVIENYSELKRQLQERGHIFRSE
TDTEVIVHLIEEHYDGDLLTAVNATLPYLRGSYAILAIAADTQRIVAARDASPLVLGIGD
SEIFAASDMTPLLEYTERVIYLEDGDVADITPDRLDIYHGGRRVERPIELISWCVEDTRK
GGFDHYMLKEIFEQPQSFYETIRAGIDDNVRQMIMGADEITLVACGTSYHTTLIFKYLAE
SLCNISVRAEMGSEFKYFVPPLRGLVIAVTQSGETADTIAALKMAKARNCSTLAITNVQG
STVTRVADSTLLMRAGPEIGVAATKSYTAQLAALMQIVNLRCERAFDDVLSHAHLAIGDV
LLYDVRDAVALCSKADHAFFVGRGAFYPVAMEGALKMKEISYVHAEGYAAGELKHGPFAL
LTPETPVVAICTPGPTYSVMASNIKEMKARRAPVIALGVDGDKELAEIVDIFIPIPNTHL
LVQVLTASVVLQLLAYHTACVLQRDVDKPRNLAKSVTVE
Download sequence
Identical sequences I7LJU7
gi|397780595|ref|YP_006545068.1| WP_014867328.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]