SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780999|ref|YP_006545472.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780999|ref|YP_006545472.1|
Domain Number 1 Region: 52-169
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00000000183
Family MJ1460-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780999|ref|YP_006545472.1|
Sequence length 187
Comment hypothetical protein BN140_1833 [Methanoculleus bourgensis MS2]
Sequence
MSAGYIDEMHEAFRSELVYRAEEIPLECTPGPKEMEQTLHGVMKLNGLVIRSLEEIAGRG
ANAVTYRAGKKFGHEIAKYFQKREDVEGALHELSDLLRGQYSFEVWKPEDKETFIIEENG
ETFIYLVFHDCIVRQTLRRNGLDQGGPLCQTLFGYVVGAIEEITGRKAKLEIVHTGPNAC
LKKLILK
Download sequence
Identical sequences A0A0X3BNT8 A0A163BPD5 I7KDE6
WP_014867730.1.51038 WP_014867730.1.63524 WP_014867730.1.88179 gi|397780999|ref|YP_006545472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]