SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397781450|ref|YP_006545923.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781450|ref|YP_006545923.1|
Domain Number 1 Region: 164-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.2e-65
Family Actin/HSP70 0.00000121
Further Details:      
 
Domain Number 2 Region: 357-514
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 4.45e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000266
Further Details:      
 
Domain Number 3 Region: 5-161
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.05e-57
Family Actin/HSP70 0.00000363
Further Details:      
 
Domain Number 4 Region: 483-576
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000000051
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781450|ref|YP_006545923.1|
Sequence length 609
Comment molecular chaperone DnaK [Methanoculleus bourgensis MS2]
Sequence
MVSEKVLGIDLGTTNSCMAIMEGGRATVIANAEGGRTTPSVVAFTKEGERLVGNVAKRQA
ITNPNRTIQSIKRKMGTSEKVAIESKNYTPQEISAMILQKLKLDAEEYLGEKITKAVITV
PAYFNDAQRQATKDAGTVAGLEVLRIINEPTASALAYGIDKEGEATVLVYDLGGGTFDVS
ILQLGDGVFEVKSTAGNNRLGGDDFDKLVVDYLVDEFRKKEGVDLKKDPVAMQRLRDAAE
NAKIELSTVQKTNINLPYITTTESGPKFLDFDLTRAKFEQLIADLVDSTLGPVKQALADA
KLSADDIDHVLLVGGSTRVPLVQETVKKVLNKEPDKGINPDECVALGAAIQAGVLTGETK
DVLLLDVTPLSLGIETLGGIATKLIERNTTIPTRKSQIFSTAADGQTSVEIHVMQGERAL
AKDNFTLGRFQLTGIPAAPRGIPQIEVTFDIDANGIVHVSAKDLGTGNEQSITIKPQDSR
PSEAEIQRMMDNAKKFEEEDKKKREEIDLRNTADTAIFTAERALKEAKDTIDATERQKIE
DAIADLKKALEGDDLEAIKQKMDTLTEAVYAVTTKMYQQAQAAAQQQEGEGAAKKDDTVV
DADYEVKEE
Download sequence
Identical sequences I7LKQ4
WP_014868180.1.51038 gi|397781450|ref|YP_006545923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]