SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781699|ref|YP_006546172.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781699|ref|YP_006546172.1|
Domain Number 1 Region: 88-156,212-281
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 11-97
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 3 Region: 136-212
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-16
Family Short-chain ferredoxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781699|ref|YP_006546172.1|
Sequence length 284
Comment nitrite and sulphite reductase 4Fe-4S region [Methanoculleus bourgensis MS2]
Sequence
MTDGKKSKKQGVIRLREKGKVAVRGRIPAGVMTASQMAAVARIAEEFGNGEVAMTARLNV
EIPFVDRRDAEEVAERLREAGIEPGSTGATLRSVVACKGTVCRHGCCDTQGLARAIEERY
GGCVLPRKLKISIAGCPNNCARVQLNDIGIAGRRFPAFHAGDCEGCGACEKVCREGAIRV
ADDRVSFSGEDCVGCGDCIAVCPKDAIGITSEGLCLSIGGRSGRVLQVGTEAEGLVTEDE
VPGIVGRLLDYFRENAQPGERLGELMGRVGEDKVFAAAGLRPRR
Download sequence
Identical sequences I7KE47
WP_014868427.1.51038 gi|397781699|ref|YP_006546172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]