SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397779524|ref|YP_006543997.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779524|ref|YP_006543997.1|
Domain Number 1 Region: 13-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000014
Family ScpB/YpuH-like 0.053
Further Details:      
 
Weak hits

Sequence:  gi|397779524|ref|YP_006543997.1|
Domain Number - Region: 105-134
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0051
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779524|ref|YP_006543997.1|
Sequence length 268
Comment hypothetical protein BN140_0358 [Methanoculleus bourgensis MS2]
Sequence
MTNLAEDPLYVILRSKRESTRFQILVEIAEHQPSIRQQEIAEKLGVTPQAVSEYIREMVD
DGLVTAHGRGRYEVTKSGIEWVLRHAEVLESYARHITRDVIQQVAVWTAIARNELKKGDT
VGVFMQDGWLYATKEQQSAMGQATMDARPGEDVGVAHLNGIIDHEEGAIHVCKVPRIERG
GSRQVRTDLLRAAIRDADMVASVGLESYVALKKAGIEPDMFFGSREGVIEAAFHGRQCAI
LIVDEEFTDFLKRLETVGLTYIIHDIAP
Download sequence
Identical sequences A0A162VJQ6 I7KB74
WP_014866258.1.51038 WP_014866258.1.88179 gi|397779524|ref|YP_006543997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]