SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397779971|ref|YP_006544444.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779971|ref|YP_006544444.1|
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.11e-26
Family HxlR-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779971|ref|YP_006544444.1|
Sequence length 119
Comment hypothetical protein BN140_0805 [Methanoculleus bourgensis MS2]
Sequence
MHAECTVNQTVKYLGRKWTLLIILELYKGENYTRRFTEIKEQLPGITAKVLSARLKELEE
EGLVKKRVEAGSVPVRSEYTLTGSGLGLVEVIKDIKRWALRWKIDNLACGAQDCHDCML
Download sequence
Identical sequences A0A0X3BJW5 I7J7V8
gi|397779971|ref|YP_006544444.1| WP_014866705.1.51038 WP_014866705.1.63524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]