SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780036|ref|YP_006544509.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780036|ref|YP_006544509.1|
Domain Number 1 Region: 95-168
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 0.0000000000000012
Family Iron-dependent repressor protein, dimerization domain 0.0049
Further Details:      
 
Domain Number 2 Region: 34-126
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000183
Family Iron-dependent repressor protein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780036|ref|YP_006544509.1|
Sequence length 175
Comment iron dependent repressor [Methanoculleus bourgensis MS2]
Sequence
MRGTVRRPWSREFSPTENFSSPNANACIMQGITGSELTPRKAEYLKYIYLQGDVVKTTDI
AAHFSVAPSTVTKALADIAKAGYLEHSPYHGVRLTAPGTDYARFLFRRHRIVALVLSRYG
LEPAEACREAKKIEQCISRDLTNRICTSLGHPMMSVCGEIEHDHSCCCPPENRKR
Download sequence
Identical sequences WP_014866769.1.51038 gi|397780036|ref|YP_006544509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]