SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780172|ref|YP_006544645.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780172|ref|YP_006544645.1|
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000519
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 63-142
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000644
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780172|ref|YP_006544645.1|
Sequence length 143
Comment HTH-type transcriptional regulator [Methanoculleus bourgensis MS2]
Sequence
MDEIDDAILRELQRDGRMSMAALGSIVGIAPSTVFKRIEKLKKAGILERFTIVINQKCFE
HTLVAFLNIRVDPDEKMEVEEFMRDLPGILEVYEVLEPGDFFAKVRVQNITELKRSVLMP
LSSLPGVKDIQTIISVRKIKERS
Download sequence
Identical sequences I7LM41
gi|397780172|ref|YP_006544645.1| WP_014866905.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]