SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780252|ref|YP_006544725.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780252|ref|YP_006544725.1|
Domain Number 1 Region: 18-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000337
Family PadR-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397780252|ref|YP_006544725.1|
Sequence length 113
Comment regulatory protein [Methanoculleus bourgensis MS2]
Sequence
MPDDLITVVEESEDVDSTIISRVRLEILWALSELGEDGATARQLKAGLNLGDGVLYANLK
KLVEMGYLRSEKVTLEGKELELYAITPEGLLEWRRVRSWLCKLLGCEGDTCER
Download sequence
Identical sequences I7LM81
gi|397780252|ref|YP_006544725.1| WP_014866985.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]