SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780259|ref|YP_006544732.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780259|ref|YP_006544732.1|
Domain Number 1 Region: 25-264
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-20
Family Extended AAA-ATPase domain 0.03
Further Details:      
 
Domain Number 2 Region: 287-349
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000462
Family MarR-like transcriptional regulators 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397780259|ref|YP_006544732.1|
Sequence length 566
Comment transcriptional regulator [Methanoculleus bourgensis MS2]
Sequence
MPASSNVILYRYSPATLDRETLQYLLVGRQKLAESLLEEIDQASGSGTPRFFLLVGPRGI
GKSHLLTLLYQRMHDDLAERIIPVKLAEEEYSIFRASDFFLRILEEMGIGIADVIALEED
RLVRDVAVDMLKGFASTEGKQIAIFVENLHEIFNQMDKREIQALRSIFQQTNTFSVVASA
PSVFPGVSDHDEPFYNFFRIFHLLELKCAEVKELMKRVAQVSGNTAFIENFQDYEPTIEA
LFHLIGGNPRLVILLYETISRGGIDDAGKIFFEMTDEQTPYYQEVFQRLTGQRRLIFDTV
LGAETPLTPKEIAERSRLDPATVNAQLRRLERDGYVISHPMGRRTSYEARERLLGLWRAM
RRSPGRSRVFRFIEFLRDWYSPDERVAVLDMVCRELSGVAEGENQMVAIASYIATGKRNE
ALVAIENVEGPFADLDQLMQFVHLCLTLAGEELLDGNRTNGLRLIDIAYTQAGRLEPGLV
KKVTVDFLKWIIGEGEIPAIKSAVDEIIRLRGTEFQRFLKPVADAVEIVETNDTKLYSTR
MQPEEREIVAGIVQRITGSEELVPEL
Download sequence
Identical sequences I7KCH1
WP_014866992.1.51038 gi|397780259|ref|YP_006544732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]