SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780468|ref|YP_006544941.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780468|ref|YP_006544941.1|
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000726
Family MarR-like transcriptional regulators 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780468|ref|YP_006544941.1|
Sequence length 113
Comment hypothetical protein BN140_1302 [Methanoculleus bourgensis MS2]
Sequence
MSDQEEEALKIIQSQRQGVLQSELWKILEIDSRKCSRIVKRLLDAGLIERVEFRSDGIKT
YLLRAKKRAIDPCVILAGEEILPCIGCERECVPEECALLLDWMYHLAFEEFQE
Download sequence
Identical sequences A0A0X3BL40 A0A162Q5Z4 I7KZD4
gi|397780468|ref|YP_006544941.1| WP_014867201.1.51038 WP_014867201.1.63524 WP_014867201.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]