SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780801|ref|YP_006545274.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780801|ref|YP_006545274.1|
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000176
Family TrmB-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780801|ref|YP_006545274.1|
Sequence length 137
Comment hypothetical protein BN140_1635 [Methanoculleus bourgensis MS2]
Sequence
MASMARQIIVKRIERPRGKGEHEDLQWFFTSLGIGEGRDVDQVAKRILVTLLEHQPPEDG
LSVESIARDLDVSNARVNHHIRNLVDAGVVYRHRRLIYIRGNSLVSMVQELRKDALRVLD
DLEAAAAEIDALFGITE
Download sequence
Identical sequences A0A167T1Z0 I7J9C8
gi|397780801|ref|YP_006545274.1| WP_014867532.1.51038 WP_014867532.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]