SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397780945|ref|YP_006545418.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780945|ref|YP_006545418.1|
Domain Number 1 Region: 12-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.89e-38
Family Extended AAA-ATPase domain 0.00043
Further Details:      
 
Domain Number 2 Region: 288-377
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.48e-17
Family Helicase DNA-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780945|ref|YP_006545418.1|
Sequence length 380
Comment cell division control protein 6 [Methanoculleus bourgensis MS2]
Sequence
MKKNLLMWDETLFRDPEVFEIDYIPEQFNHRDAQIRELAFQVRPGLRGGRPLNTICRGLP
GTGKTTSVKKVFAEVEEVTKKLVPVYVNCQIDNTRFAIFSQIYRRVTGHLPPASGTSFKQ
VIDAIARTVLREEQVLLVALDDANYLLYENEINRVLYPLLRSHEAYPGFRTGVVAIVSDM
SVSLQNEVDARVASVFRPTEIYFPPYSEDEVRGILEERIFQGLYPNVLRPGMLDVVVEQT
MKNGDLRVGIDLIKRATLNAEKEARRSVEREDICKAYEISRYLHLAFSLRTLKTEEKQLL
WQIAEMSAHADREMNAGEVYRFAKKQVSVSYTKYYEIIKKFDAMRILNLHYRQGRGRTRL
ISLRYDPERVLEHLQQEQTI
Download sequence
Identical sequences I7LK76
gi|397780945|ref|YP_006545418.1| WP_014867676.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]