SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397781129|ref|YP_006545602.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781129|ref|YP_006545602.1|
Domain Number 1 Region: 19-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000766
Family Transcription factor E/IIe-alpha, N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781129|ref|YP_006545602.1|
Sequence length 281
Comment hypothetical protein BN140_1963 [Methanoculleus bourgensis MS2]
Sequence
MGSEITIKYTKINNFDKVGVLNEDHGDKQVTIDILKAIAREGQVFTLEQLHRQTEIPKNV
LSVMLSRWEDRGLVERIERGKYLIIPLESEKGKYTLHEFVIASHLVQPSAIAYWSALHYH
GLTEQIPITVFVQTTARKKNRQLEVFGVDYRIVRVKPEKFFGFKKEWIEETSVTVTDREK
TVIDCLDRPEYAGGIVEAAKALENASLDRENLSRYALMIGNNAVVRRLGYLSEQAGVPLD
LPLPTSRNYLLLDPTMPRQGENDPRWRLVINTEIALPEGSG
Download sequence
Identical sequences I7KDJ1
WP_014867859.1.51038 gi|397781129|ref|YP_006545602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]