SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397781132|ref|YP_006545605.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781132|ref|YP_006545605.1|
Domain Number 1 Region: 49-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000888
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781132|ref|YP_006545605.1|
Sequence length 132
Comment ATP-dependent DNA helicase RecG [Methanoculleus bourgensis MS2]
Sequence
MSCRAGLVERYESRIERIITPLRSAGMPVSTFSSTPIGFTLTMRKDLLTGSVLREMGLNE
RQVLAVERIKNEGSGTSGDDHSLTGISATTAFRDLKALVDLGILESEGPSKKKTRYILRK
GPPLGVDIFRAV
Download sequence
Identical sequences I7LN82
WP_014867862.1.51038 gi|397781132|ref|YP_006545605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]