SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386001357|ref|YP_005919656.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001357|ref|YP_005919656.1|
Domain Number 1 Region: 24-210
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.9e-39
Family TAP-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386001357|ref|YP_005919656.1|
Sequence length 211
Comment Lipolytic enzyme, G-D-S-L family [Methanosaeta harundinacea 6Ac]
Sequence
MGEAELCRSFTRRTRALLEAGAEARIVLFGDSITAGFAVRRGFDHFWLSMLKEKYPRAGI
AMQNQGACGATSFDGLARLDWSVVAHNPDLVTVNFGINDMYMGIRLGEFKGNLIEIVERI
LEGPGSGSGPELLLLSSEPLMTPKFDRIVLSYYQVLEDVAEEMGVGFVDVYGAWMRRVGE
GVPLDSLILPGLDHPNELGYRIIAEELMRFF
Download sequence
Identical sequences G7WK40
WP_014586218.1.3402 gi|386001357|ref|YP_005919656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]