SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386001425|ref|YP_005919724.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001425|ref|YP_005919724.1|
Domain Number 1 Region: 32-132
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000144
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 273-375
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000103
Family Collagen-binding domain 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|386001425|ref|YP_005919724.1|
Domain Number - Region: 404-494
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00824
Family Collagen-binding domain 0.018
Further Details:      
 
Domain Number - Region: 152-256
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0929
Family Collagen-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386001425|ref|YP_005919724.1|
Sequence length 681
Comment Peptidase domain protein [Methanosaeta harundinacea 6Ac]
Sequence
MKGIFRRSAPGLIYATFVLLMLATLGYSQMDPNEPNSELGSATWISPGVSAAGTINPAGD
VDFFGFEVESPGVLEVKLNALPHDMRARIDLYGKNFNFITRKDASNPGDLVALTLDLASP
GRYYFGIVDLAGKSHDTGYSFDLSFGPVVDVNEPNGEAGDAKSVGFGDLILGYIFPKGDA
DIYKLNVTGSGILEVKAESVPEGMKTRIDLYGKNFNFITRVDASNPGDLVTLKHDVVNPY
SWYPVSYYVGITDLSGGSYHVPYTFKADFEPVIDENEPNGEIGDAVAIAFGDQIEGYIFS
KGDVDFFKFEAPSPGILEVKTASVPEEMRTRIDLYGKSFNFITRIDASNPGDKTTLRFDV
KSPGVYHIGVVDLAGRSHKVPYSFAASFEPVVDDNEPKSEIGDAAPISPGEAVGGVIFPA
GDVDFYKIWADSPGDLEVMLESVPDEMRARIDLYGKNFNFITRADASNPGDLATLKYGAP
GPGWYYIGIVDLAGRSHSTGYSFRAVGGGLGGSGSGPQEGGAVGTKAGGVKVVSDGTANG
TATSYREATLTHSGFDFSLGETGEYPTFDGEIITWQPSAEDHPDYPRDAGYLWWRNTHLD
DQNRVSQTRDMGSVDLEAVRTVPAEWDRSPLIPPLLEGHTIVARCNDGYVKFQVISVDPE
AESVVVRYFHSPDATFDDGAS
Download sequence
Identical sequences G7WKA8
gi|386001425|ref|YP_005919724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]