SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386001533|ref|YP_005919832.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001533|ref|YP_005919832.1|
Domain Number 1 Region: 95-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.94e-61
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000709
Further Details:      
 
Domain Number 2 Region: 10-126
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.84e-42
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 317-443
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 3.92e-32
Family SerA intervening domain-like 0.001
Further Details:      
 
Domain Number 4 Region: 440-521
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000541
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386001533|ref|YP_005919832.1|
Sequence length 523
Comment D-3-phosphoglycerate dehydrogenase [Methanosaeta harundinacea 6Ac]
Sequence
MKVLVSDPLSEEGVRKLETEMEVDVITNLSPEELVERIKDYDALAIRSGTKVTAEVIAAA
DKLKVIGRAGVGVDNVDIDAATKKGIIVVNTPGGNTISAAEHTIAMMLSLARNIPLANAS
LKAGEWNRKKYTGVEVYNKTLGIVGLGRIGAEIASRMKAFGMRILAYDPFVTAERAADLG
IRLATLDEIFRESDFITVHTPLTKETRNLIDEDQFKIMKPGVRLINCARGGIINEEALAK
AVAEGRVAGAAIDVFTKEPPAGNPLLDQAGVIVTPHLGASTAEAQVNVAVAVAEQILAVA
RGELPPNALNMPAISSETLAAMRPFMDLVEKMGRLAAQLGEDGYDRLEIVYGGTVAEKDT
KPVTISAVKGFLDSLGHSANFVNSLVKLRECGIALTESKTDSTNGYSNIVTLTLSGPKGS
VSVYGTVYGKNEGRIVQINEYRVYVPTEGYMIMAIHEDRPNIIGPCCVVLGEDSINIGGM
HVGRKASGGEQIMVLNVDHPVSEETLGRLTSVSGVIKAKMIKL
Download sequence
Identical sequences G7WLA6
gi|386001533|ref|YP_005919832.1| WP_014586394.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]