SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386002321|ref|YP_005920620.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002321|ref|YP_005920620.1|
Domain Number 1 Region: 15-451
Classification Level Classification E-value
Superfamily L-aspartase-like 2.67e-121
Family L-aspartase/fumarase 0.0000000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386002321|ref|YP_005920620.1|
Sequence length 477
Comment argininosuccinate lyase [Methanosaeta harundinacea 6Ac]
Sequence
MLLRGERLGEISGDVLEFISSRDADRQIFEADLLVDRAHLAMLKERGLIAAEEFSAIVAA
LDGIELAELGEGEDVHEAIEAELIARVGAVGGRMHTGRSRNDEVATCIRIVLRGELLGLM
AEVNDLAEALVERAAENADTVIPGFTHLQHAQPTTLAHHLLAHADALLRDFDRLQDSCQR
VNRSPLGAAAFASTGFDIDRKRTAELLGFEGLVENSMDAVSTRDFLLEALSASAILMVNA
SRLAEELILWSTSEFGYLELDDLFTSTSSIMPQKKNPDTAELIRGKTGTVFGSLVAALAI
VKALPMSYNRDLQEATPNLWRGISTTRGAVRILTGAVSSAKFNKERLEAASGAGFSTATE
IADSLVRKTKIPFRTAHQIVGALAAKGGTPAIEDLDEAAERIAKFRPSERGFGEEELAAA
LDPRRNVAVRSRIGGPAPEETKRMAADRRRRIEENGRLVEEMRGRVDSALAALREMR
Download sequence
Identical sequences G7WPW6
WP_014587179.1.3402 gi|386002321|ref|YP_005920620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]