SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386002397|ref|YP_005920696.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002397|ref|YP_005920696.1|
Domain Number 1 Region: 678-936
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-96
Family BC ATP-binding domain-like 0.000000805
Further Details:      
 
Domain Number 2 Region: 128-398
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-95
Family BC ATP-binding domain-like 0.000000395
Further Details:      
 
Domain Number 3 Region: 561-680
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.17e-51
Family BC N-terminal domain-like 0.00000175
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.03e-47
Family BC N-terminal domain-like 0.0000029
Further Details:      
 
Domain Number 5 Region: 941-1076
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 3.14e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00079
Further Details:      
 
Domain Number 6 Region: 393-556
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.4e-33
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386002397|ref|YP_005920696.1|
Sequence length 1079
Comment Carbamoyl-phosphate synthase, large subunit [Methanosaeta harundinacea 6Ac]
Sequence
MPKREDIKKIMIIGSGPIVIGQACEFDYSGTQACKALRELGYKIVLVNSNPATIMTDPGM
ADVTYIEPLNLERMTQIIEKERPDALLPNLGGQSGLNLSSELAKAGVLERYGVRVIGVET
DAIERGEDRIIFKETMERLGIDMPKSTAVYSVEDAEKVAADLGYPVVVRPAYTMGGTGGG
LVYNVEELRTVASRGIAASLIGQVLIEESVLGWEELELEVVRDAKNQMITVCFIENVDPM
GVHTGDSYCTAPMLTISNELQARLQDYSYRIVEAIAVIGGTNVQFAHDPKTDRVVVIEIN
PRTSRSSALASKATGFPIALVSAKLACGLTLDEIPYWREGTLERYTPSGDYVVVKFARWA
FEKFKGAEDRLGTQMKAVGEAMAIGKTYKEALQKAIRSLEIGRHGLGFAKDFHQRSLPEL
LDMLKWPSSERQFIIYEALRKGASVQEISDLTRIKPWFLQQMKELVELEEEILSFRARTG
EGVAEADLLSTIPDALLRRAKEDGFSDKYLSKLLSISEREIRTRRKALGIVQGWEPVPVS
GVEDAAYYYSTYHRTDAPKRSDRRKVMVLGGGPNRIGQGIEFDYCCVHAAFALRDMGYET
IMVNCNPETVSTDYDTSDKLYFEPLTVEDVISIYERERPEGMIVQFGGQTPLNIARELEE
AGARVIGTSVDTIDLAEDRDRFRMMMEKMEIPMPESGMASNLDEALEVAARIGYPLMVRP
SYVLGGRGMEVIYDEEMLERYVAAAVDVTPERPILIDRFLENALEAEADALSDGTSTFVP
AVMEHIEQAGVHSGDSACVIPPVTIPKRQIETIKEYTCKIAKELGVVGLMNMQYAIAKDV
VYVLEANPRASRTVPLVSKVCNVSMARIATELMMGRGLAEIGLQERGVPHFGVKEAVFPF
NMFPEVDPLLGPEMRSTGEVLGMADSFGMAFYKAEEAARQTLPQEGTVLITVASKDRPKV
LEAAKEFSRMGFAIRATRGTQEYLAENGIESELILKLTEGRPNIDDAIKNGEIQLVINTP
IGKASQYDDSYIRKAAIKYKLPYITTPAAASAAAKGIAALRRGRSGVKALQEYHADIKG
Download sequence
Identical sequences G7WQT0
WP_014587254.1.3402 gi|386002397|ref|YP_005920696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]