SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386002805|ref|YP_005921104.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002805|ref|YP_005921104.1|
Domain Number 1 Region: 168-359
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.07e-61
Family Actin/HSP70 0.0000013
Further Details:      
 
Domain Number 2 Region: 361-517
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 9.94e-61
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000002
Further Details:      
 
Domain Number 3 Region: 1-165
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.86e-51
Family Actin/HSP70 0.0000087
Further Details:      
 
Domain Number 4 Region: 484-582
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000000353
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386002805|ref|YP_005921104.1|
Sequence length 619
Comment Chaperone protein DnaK [Methanosaeta harundinacea 6Ac]
Sequence
MSKIIGIDLGTSNSAAAVLIGGKPTMIPSAEGTSIVAGGKAFPSYVAFTKDGQRLVGEPA
RRQAATNPEGTITGIKRKMGQDYRVEVYGKSYTPQDISSFILRKIKDDSEAFLGEKVEKA
VITVPAYFNDNQRQATKDAGTIAGLDVVRIINEPTAAALAYGMDKEGEATLMVFDLGGGT
LDVTIMEAGEGVFEVKSTSGDTQLGGRDMDEILTNYVVERYRQESGIDLKGDRMAMQRLR
EAVEIAKIELSSVLQTTINLPYITADQTGPKHLEMTITRAKLEELIKEVLERCRNPMIQA
IRDAKLDKSGIDKIVLVGGPTRMPAVRKFVTEFMGKEPEGGVDPMECVAIGAAVQGGVLG
GEVKDILLLDVTPLSLGIETLGGVATKLIERNTTIPTRKSQIFTTAADNQTTVEIHVLQG
ERPLAKDNTSLGRFTLSGIPPAPRGIPQIEVAFDIDANGILNVSAKDLATGKEQAITISA
PHKLSQNEIERKIREAEQHAYEDTRRKEEIEAKNQAETLVYTAEKTLKDAGEVVTADQKE
KIERAIGEAKEALAGGDIAKIKEKTEALQNAIYELSTAMYQRAAEQQQREQEKQQQSQGG
PTASGETIDADFEVVNDKR
Download sequence
Identical sequences G7WQC8
WP_014587657.1.3402 gi|386002805|ref|YP_005921104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]