SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386002873|ref|YP_005921172.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002873|ref|YP_005921172.1|
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily Transposase IS200-like 5.76e-26
Family Transposase IS200-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386002873|ref|YP_005921172.1|
Sequence length 82
Comment Transposase IS200-like protein [Methanosaeta harundinacea 6Ac]
Sequence
MINQEIMPDHVHIFVTAHPIFAPANIAKIFKGITAKKLFEKHPELRNQLWNGHLWNPSYY
VGTCGDTTKDVIERYVEMQKVK
Download sequence
Identical sequences G7WR88
gi|386002873|ref|YP_005921172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]