SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386002961|ref|YP_005921260.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386002961|ref|YP_005921260.1|
Domain Number - Region: 199-247
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00863
Family Cna protein B-type domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386002961|ref|YP_005921260.1|
Sequence length 287
Comment hypothetical protein Mhar_2285 [Methanosaeta harundinacea 6Ac]
Sequence
MNRILAVCLLLAFAIAGGHAHDTWLMTTSGWASEGDLALVQMTEGHSFVPMAPPPGDISI
RVTGPGGYDRSFDLDETTATNGPYYRTDFDVESPGLYVATGEQHEGPLTFVRTKFGAPDE
EMDGYDEIAWDEVETSGWDPDWYIAEAYEDLVKFSKLFIVAENADFASASVPIGQRLEIV
PLENITALGTGDFRFLVLFDGEPAAGLEVRLATTANPSVGKGVTDEDGVVLLAVPEPGLW
IVATEHKDGEMVLLPQHGPDAVEESFVGTGYFSVLTLRQDYTKPEAD
Download sequence
Identical sequences G7WQK3
gi|386002961|ref|YP_005921260.1| WP_014587813.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]