SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336476576|ref|YP_004615717.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476576|ref|YP_004615717.1|
Domain Number 1 Region: 4-444
Classification Level Classification E-value
Superfamily L-aspartase-like 2.83e-123
Family L-aspartase/fumarase 0.0000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336476576|ref|YP_004615717.1|
Sequence length 447
Comment adenylosuccinate lyase [Methanosalsum zhilinae DSM 4017]
Sequence
MAIHPIEYRYGTAEMKYVWEEVNRLDKLLSVEAALAKAEADVALIPSEAADEISKAINSV
DLGRVKEIEDEIHHDMMAIVLAISEKCSDDAGKWVHFGATSNDILDTATALQIKDAVNIF
EKKLKRLLDVLLKQAIDHKYTVCAGRTHGQIGVPTTYGLKFAIWASEVSRHLERLDQMKP
RITVGQMTGAVGTQAAFGKQGITIQKLTMEYLGIAPVDVSNQIIQRDRHAEFVMWMANVV
TTLDKIGIAIRTLQRSEIAEIEESFGKNQVGSSTMPHKRNPIKSEQICGLSRIVRSMVEP
QLLNNTLWDERDLTNSSCERIVFPEACVLTDHIIKLGIDVISNLRFYPDNIRRNLNLMKG
LNMGEAVMIELAKKGVGRQEAHEIVRSCAMKAHETDRHLKDTLLENRTVSIHLSEREISR
LVTPDMYIGTAVEQIEILVSKLKPMIE
Download sequence
Identical sequences F7XQJ6
WP_013897937.1.3471 gi|336476576|ref|YP_004615717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]