SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336476604|ref|YP_004615745.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476604|ref|YP_004615745.1|
Domain Number 1 Region: 673-935
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.31e-108
Family BC ATP-binding domain-like 0.000000281
Further Details:      
 
Domain Number 2 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-102
Family BC ATP-binding domain-like 0.000000137
Further Details:      
 
Domain Number 3 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.62e-47
Family BC N-terminal domain-like 0.00000478
Further Details:      
 
Domain Number 4 Region: 549-675
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.19e-46
Family BC N-terminal domain-like 0.0000067
Further Details:      
 
Domain Number 5 Region: 393-546
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.01e-45
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00015
Further Details:      
 
Domain Number 6 Region: 940-1073
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.06e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336476604|ref|YP_004615745.1|
Sequence length 1082
Comment carbamoyl-phosphate synthase large subunit [Methanosalsum zhilinae DSM 4017]
Sequence
MPKRNDIKKILLIGSGPIMIGQAAEFDFSGSQACRSLKEEGYEVVLVNSNPATIMTDPET
ADAVYIEPLEARVIEKIIEKERPDGIIAGIGGQTGLNMTSELAELGILDKYGVKLLGTSL
DAIRDTEDRELFKQAMERVGEKVARSRAISSIADAEKMIDELGLPLIVRPAYTLGGAGGG
IARTRDELLQIVENGLRRSRINQVLIEESVLGWKEFEYEVIRDSNDTCLVICNMENIDPM
GIHTGESMVVTPSQTLTDEEHQTLRSAAIKIIRSFGIEGGCNIQFAAKDGEYRVVEVNPR
VSRSSALASKATGYPIARVSAKIAVGMRLDEILNDVTKKTPASFEPTIDYVVTKIPRWPF
DKFVTADKTLTTSMKSTGEVMSIGRTIEQSLLKAVRSLDIDIDLGSGKWDRNEIINLLKI
PTSERLFVIYKALETGFTVDEICEMSSIDPFFIQKMKNIVDIEDEFRKYSNLPVEEIPSS
LLKKAKRMGLTDSRIAALTDKTREEINDLRRSTGISVTYKMVDTCAAEFAAATPYYYSCY
ETQCEAEPTDRKKILIIGAGPIRIGQGIEFDYCTVHAVSAIRSEGIETHIINNNPETVST
DYDTSDKLFFEPITLEDVMNVIDRERPYGVLVQFGGQTSVNLALSLENELKRRQDLETVI
LGTSPESIDIAEDREKFNQMMNRLDIKQPDAGYATSHEEALKIASRIGYPVLVRPSYVLG
GRAMEIVYDRNDLERYMREAVRVSPEHPILIDDFLEGAIEIDVDAVCDGKDVLIGAIMEH
IEEAGVHSGDSACVIPPQSLSEDTLSTVREYTRKIALSLNVKGLINIQMAKKGDDIYVLE
ANPRSSRTIPFVSKAVGLPLAKIAAQVIIGHTLKDLGYTQEKEPSVDHVSVKEVLLPFDK
LPGADPVLGPEMKSTGEVMGIDYSFGLAFFKAQLSAENLLPLAGKVFMSIRNEDKEKMVE
VARKMQKVGLELMGTRGTSNYMSEHGIEMETIKKVHDGSPNVIDMLRRNEVSLIINTPTS
KQARKDGYQIRRAAVDFRVPYITTVQAAVAAAEAMDAMKNGDIIIKSVNDYNREVLQGSY
KQ
Download sequence
Identical sequences F7XK61
gi|336476604|ref|YP_004615745.1| WP_013897965.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]