SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336476631|ref|YP_004615772.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476631|ref|YP_004615772.1|
Domain Number 1 Region: 30-290
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.09e-79
Family Alanine racemase-like, N-terminal domain 0.000000828
Further Details:      
 
Domain Number 2 Region: 272-422
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.3e-51
Family Eukaryotic ODC-like 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336476631|ref|YP_004615772.1|
Sequence length 426
Comment diaminopimelate decarboxylase [Methanosalsum zhilinae DSM 4017]
Sequence
MFTIKNHLEIEDGQLTIGGIPAVEIVKQYGSPVYVSNESRIRDNFRRYKDAFPDADLYYA
AKANSNLTLFKIMASEGAGADVFSDGELYLALMAGIPRDKILFNGNSKSDRELLMAVKTG
VRVSLDSIDELRTLSRIAKKEKKIVDVSFRVNPDVSPQTHPKISTGLKASKFGIPHEEAV
HAYKEALDLPGVNPIGIHCHIGSQILEISPFSEAMNKMMDLVEQISRLGVDVKFVDMGSG
LGIPYEKGKAVPSPKDLADLILPIFKSRCRDEGISPKLILEPGRYIMGDSTLLLTTVNTM
KEAAKKFVGVDAGFNLLIRPAMYDSYHLAVVANKADKKPEEIYSIVGPICESGDILAHDR
ELPRIEKGDIIAFFDAGAYGFSMSSQYNGRTRCAELLINDGMIDVIRKAESYDDLLANQL
VPSRFL
Download sequence
Identical sequences F7XK88
WP_013897992.1.3471 gi|336476631|ref|YP_004615772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]