SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336476750|ref|YP_004615891.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476750|ref|YP_004615891.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Transposase IS200-like 2.35e-34
Family Transposase IS200-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336476750|ref|YP_004615891.1|
Sequence length 131
Comment transposase IS200-family protein [Methanosalsum zhilinae DSM 4017]
Sequence
MKYEKKNHSKFLLLYHVIFVCKYRRKALIDIEIELKDTLNDIAAKSNFEIVEMETDEVHI
HLLIKSQPKYSILSIVRRLKQESTYRLWEQRELHLKYYYWHERTLWSDGYFCSTIGNVSK
EMVLEYIRNQG
Download sequence
Identical sequences F7XKX4
WP_013898111.1.3471 gi|336476750|ref|YP_004615891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]