SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336476954|ref|YP_004616095.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476954|ref|YP_004616095.1|
Domain Number 1 Region: 98-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.77e-60
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000778
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.64e-37
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 316-445
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 1.91e-36
Family SerA intervening domain-like 0.0017
Further Details:      
 
Domain Number 4 Region: 440-521
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000258
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336476954|ref|YP_004616095.1|
Sequence length 523
Comment D-3-phosphoglycerate dehydrogenase [Methanosalsum zhilinae DSM 4017]
Sequence
MKILVSDPLSEEGIEKLKESFEVDIATGLSEDELAQKIGDYSALVIRSGTNVTKKIIDSA
DNLKIIGRAGVGVDNINVDAATEKGIIVVNAPEGNMISAAEHTIAMIMSLSRNIPQANMS
LKSKKWERKKFMGVEVNGKILGVIGLGRIGTEVAIRAQGLEMRVVAYDPYISEERANELG
VELSSVHEIMKKADFITVHTPLTKETRNIIDYEEFGLMKNGVRVINCARGGIINEAALID
SLKSGKVAGAALDVFVNEPPFDNPLLEFENVIVTPHLGASTEEAQINVAISIAEEVISVL
KGGFAKNTINIPAIKPEMMSVLQPYIDLGETMGSVLGQLVGGKHRKVEVAYNGEISEKDI
RPVTTAALKGLLETVLGSGINYVNAHKVAKARKIEVIESKSDKSEEYSSTITIRMVKDGE
TRSITGAVVGNEAKIVNIDNYRVDIVPRGYMIVSNHINRPNVIGPCCLVLGRNNINISGM
QVGRVGIGEVTIMALNVDSEVPEPILDEIRSIEGIIDANLIKL
Download sequence
Identical sequences F7XLP8
gi|336476954|ref|YP_004616095.1| WP_013898314.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]