SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336477322|ref|YP_004616463.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336477322|ref|YP_004616463.1|
Domain Number 1 Region: 26-172
Classification Level Classification E-value
Superfamily YutG-like 1.7e-31
Family YutG-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336477322|ref|YP_004616463.1|
Sequence length 179
Comment alpha-ribazole phosphatase CobZ [Methanosalsum zhilinae DSM 4017]
Sequence
MKLSDMESRDLKGDQPETLENEPDNDILKVLEYEGITLEMLVDAAMELYVPHPGIETREK
AEEMFIRELKIAISDPNLSLLIYSGILLERQGITGNLPGISKESFEKDLTFIVADEVIGM
SISKYISGDKGMFEFVRFDKAKPGILAQMGPFMDDVLAGLIGGVSANMYTRAMAEIDIQ
Download sequence
Identical sequences F7XNI4
gi|336477322|ref|YP_004616463.1| WP_013898681.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]