SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121009|ref|YP_004575784.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121009|ref|YP_004575784.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.57e-38
Family CbiG N-terminal domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 186-338
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 6.02e-24
Family CobE/GbiG C-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121009|ref|YP_004575784.1|
Sequence length 340
Comment cobalamin (vitamin B12) biosynthesis CbiG protein [Methanothermococcus okinawensis IH1]
Sequence
MIKIVYITKKGEILANNIKHILDYYFYDNRIYHSKDLTIDGNEKGFIFIMATGIVLRKYI
DKIKKDKTKDAFVIVLDELGKNIIPILSNHLGGGNYFSKLIGRELKENVVFTTATDVNNK
VGIDELSNIYFLDVPKKKDILKINKKVLYEKVDLTLPNGWKPLKNVLNTYNIKYHNNNYV
IVDRDIILKPKNIVVGIGARKNIKSYNVYWAVKKALYLRDIPIWRVNAFATVDVKKDEKG
ILETAKRFKKKLFIFDRKDISEIYKIRDDLIKSDFVFKTIGVYGVSEPVSILGVKKLNDL
ENIKDISNMDINRDINYINHINLVLKKFKKNGVSISISIG
Download sequence
Identical sequences F8AMG6
gi|336121009|ref|YP_004575784.1| WP_013866192.1.9613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]