SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121422|ref|YP_004576197.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121422|ref|YP_004576197.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily YaeB-like 1.05e-32
Family YaeB-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121422|ref|YP_004576197.1|
Sequence length 121
Comment hypothetical protein Metok_0435 [Methanothermococcus okinawensis IH1]
Sequence
MEFKIHPIGYIKQLDDKTVLNIFEEYKEGLDGLKEGLKIVLILWFDKSDTPQKRKTLKVH
PLGNPHNPIRGVFSTRSPIRPNPIALYEAKISKIDENNIFIEKIDAYEGTPIIDIKIAYN
Q
Download sequence
Identical sequences F8AKS7
gi|336121422|ref|YP_004576197.1| WP_013866605.1.9613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]