SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121465|ref|YP_004576240.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121465|ref|YP_004576240.1|
Domain Number 1 Region: 9-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.22e-69
Family G proteins 0.00000532
Further Details:      
 
Domain Number 2 Region: 467-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-44
Family Translational machinery components 0.00014
Further Details:      
 
Domain Number 3 Region: 259-379
Classification Level Classification E-value
Superfamily Translation proteins 3.09e-31
Family Elongation factors 0.0012
Further Details:      
 
Domain Number 4 Region: 630-725
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.68e-26
Family EF-G/eEF-2 domains III and V 0.00047
Further Details:      
 
Domain Number 5 Region: 390-467
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.91e-18
Family EF-G/eEF-2 domains III and V 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121465|ref|YP_004576240.1|
Sequence length 727
Comment translation elongation factor aEF-2 [Methanothermococcus okinawensis IH1]
Sequence
MGRRAKMVEKVKSLMETHDRIRNIGICAHIDHGKTTLSDNLLAGAGMISKDLAGDQLALD
FDEEEAARGITIYAANVSMVHEYEGKEFLINLIDTPGHVDFGGDVTRAMRAIDGAIVVVC
AVEGVMPQTETVLRQALKEKVKPVLFINKVDRLLNELKLTPEELMNRFTKIINDVNKLIQ
KMASEEFKKEWIVNVMDGSVAFGSAYHNWAISVPYMKKTGITFKDIIDYCENENQKELAQ
KAPLHEVLLDMVIKHLPNPLEAQKYRIPNIWKGDLESEIGKAMINCDPNGPLAGVITKII
MDKHAGAISACRLFSGRVKQGDELYLVSMKQKARAQQVAVFMGAERIQVPSVSAGNICAL
TGLKEASAGETICSPDSIIEPPFESITHVSEPVITVAIEAKNTKDLPKLIEVLRQIARED
NTVRVEINEETGEHLISGMGELHIEVITNTKIGRDAGIEVDVGEPIVVYRETVTGTSPEV
EGKSPNKHNKLYFVVEPLEESVYNAYKEGKIKDEDFKKKTPQEVEKVLVEAGLDKEEAKR
VMSIYEGNILLNMTRGIVQLDEARELIIEGFKEAVRNGPLAAEKCQGIKVKLVDAVFHED
AIHRGPAQLIPAVRFGIRDAIMQAKPVLLEPIQKVYINTPQDYMGDAMRELSNRRGQILD
MEQEGDMTLIKAKAPVSEMFGFAGAIRGATQGRCLWSVEFGGFERVPNELQPKIVKEIRE
RKGLKTE
Download sequence
Identical sequences F8AL26
gi|336121465|ref|YP_004576240.1| WP_013866648.1.9613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]