SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121947|ref|YP_004576722.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121947|ref|YP_004576722.1|
Domain Number 1 Region: 122-196
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.000000000000536
Family Siroheme synthase middle domains-like 0.0056
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000841
Family Siroheme synthase N-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336121947|ref|YP_004576722.1|
Sequence length 207
Comment siroheme synthase [Methanothermococcus okinawensis IH1]
Sequence
MMIPIFVNLEKFKVCIFGFGDVGKRRFNKLLNANPYKITIYSKDIDQEEINKYENNYRNV
EFITCDINNLSNDDLKNIIQKYDFIISAIDEKNNKRIVHISKKLNKFISSSTFEKNINLI
IPAYCNVDDIYFTVYTQGKSPLIAKNIRKLVENYLKNHEYDIDAQNSIRDFLKNNISSQK
DRKRILEKIFKNKDFKREFLELVDKYK
Download sequence
Identical sequences F8AN30
gi|336121947|ref|YP_004576722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]