SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121976|ref|YP_004576751.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121976|ref|YP_004576751.1|
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-30
Family Translational machinery components 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336121976|ref|YP_004576751.1|
Sequence length 134
Comment 30S ribosomal protein S9P [Methanothermococcus okinawensis IH1]
Sequence
MKVIHTVGKRKTAIARATAKEGKGRIRINKKPVEIIEPKYVNAKLMEPVILAGDAIDNID
IDITVKGGGIAGQMDAARTALGKAIVEYTGSMEIKERYLEYDRTILVSDARRTEPHKPSK
STKGPRAKRQKSYR
Download sequence
Identical sequences F8ALH6
WP_013867157.1.9613 gi|336121976|ref|YP_004576751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]