SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336122174|ref|YP_004576949.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336122174|ref|YP_004576949.1|
Domain Number 1 Region: 454-625
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-58
Family DNA gyrase/MutL, second domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 16-223
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-29
Family DNA gyrase/MutL, N-terminal domain 0.00098
Further Details:      
 
Weak hits

Sequence:  gi|336122174|ref|YP_004576949.1|
Domain Number - Region: 274-451
Classification Level Classification E-value
Superfamily Sec1/munc18-like (SM) proteins 0.0549
Family Sec1/munc18-like (SM) proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336122174|ref|YP_004576949.1|
Sequence length 658
Comment DNA topoisomerase VI subunit B [Methanothermococcus okinawensis IH1]
Sequence
MAESDVIFDEFKEHSISEFFRKNRHMLGYSGKLRSMTTIIHELVTNSLDACEEAEILPDI
DIEIKKLGADHYKVVVEDNGPGIPPEFVPKVFGKMLAGSKMHRLVQSRGQQGIGAAGVLL
FAQITTGKPLKITTSTGNGEIHTMEIKMSIEKNEGDVVSHEVRSGFWRGTKVEGEFKEVT
YNRREQGPFEYLRRISLSTPHAKITLKDPEETVVFDRTVEDIPERPEEMKPHPYGLTPDE
LLYISRKTESIKISSMLTSELSRMTSKRIKELQEYILRDKLLENYRDSTFWDIVVDCYLN
VKINDYIEKYAKYVDKKEISDVKEIINTLPDSLSELKIYYLKYLIMDYLIEKLDEETINE
IKKHFKKKPENFIEFAEKNYLNASLMDEFNRKLRTITKSPKEFVDSLVNMAMVSEAELER
FKNEVKNLLKKNPRDMNWNDAELIVRVIQDMDFMAPSTAGLRPIGEENIQKSLKTLNPEF
VKTITRRPKTYKGGIPFAVEAGLAYGGDAGRISDNTRKMEIMRFANHVPLLFDTSGCGIT
NAVKSINWRRYGLRSDEDVPLTVFVNLISTHIPYTSAGKQAVACSSEENEEIFNEIRQAL
MICARGLEKHISKIRREKEEEQKKKYVLKYAVIFAEGLANITNKPKELIEERIIELLR
Download sequence
Identical sequences F8AJI5
WP_013867354.1.9613 gi|336122174|ref|YP_004576949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]