SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336122317|ref|YP_004577092.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336122317|ref|YP_004577092.1|
Domain Number 1 Region: 6-125,248-398
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 5.89e-86
Family Substrate-binding domain of HMG-CoA reductase 0.00000581
Further Details:      
 
Domain Number 2 Region: 128-250
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.19e-41
Family NAD-binding domain of HMG-CoA reductase 0.0000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336122317|ref|YP_004577092.1|
Sequence length 408
Comment 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanothermococcus okinawensis IH1]
Sequence
MEDITKIVEKLKNKEIKPYQLDNMFDSKKSVEIRRKYIESLTDTAFKHIDKYSINEKEAM
EKNIENMIGAVQIPLGFAGPLKINGKYANGEYYIPLATTEGALVASVNRGCGIITKCGGC
TVRVVDDKMTRAPVIKTNSIIDAIKLKEWIENNFQKIKEVAETTTKHGKLISINPIIIVG
RYVYPRFTYKTGDAMGMNMVTIATEKACNFIENEMKKEENGSIKVHTVALSGNVCTDKKP
AGINLIEGRGKTIIAEVFLKEEEIKKYLKTTSKAIEQVNMYKNFIGSAISNSMGFNAHYA
NIIGALFLATGQDEAHIVEGSMGITVAECVDDGLYFSVTLPDVPIGTVGGGTRVETQKEC
LEMIGCRGGDKALKFAEIVGGAVLAGELSLMGALAAGHLAKAHSELGR
Download sequence
Identical sequences F8ALT4
gi|336122317|ref|YP_004577092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]