SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336122454|ref|YP_004577229.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336122454|ref|YP_004577229.1|
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily LigT-like 1.15e-34
Family 2'-5' RNA ligase LigT 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336122454|ref|YP_004577229.1|
Sequence length 171
Comment 2'-5' RNA ligase [Methanothermococcus okinawensis IH1]
Sequence
MRCFLAIELNEDIKEKLKELSSHFKINGIKLVKMDNLHITVKFLGDIDEEMIEKIKNLDL
SIKPVKSDIKHIGVFPNENYIRVIWVGVTNLIPIFKKIDEKLSELGFKKEKDYIPHITIG
RVKFIKDKKLLKNKIDKYKHTELGTIEVKNIVLMKSELTREGPIYEVIKKW
Download sequence
Identical sequences F8AK80
WP_013867632.1.9613 gi|336122454|ref|YP_004577229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]