SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336122571|ref|YP_004577346.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336122571|ref|YP_004577346.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily DsrEFH-like 0.00000000000000163
Family DsrEF-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336122571|ref|YP_004577346.1|
Sequence length 116
Comment hypothetical protein Metok_1605 [Methanothermococcus okinawensis IH1]
Sequence
MKNAFLIFSYMHNNKPNMAVMMHVLLFAKEMNEKGDNVKIIFEGEGVNWAKDLLNEDHPL
SNHAKPLLNNFVVCEACANMFGVLDDIKGKLNIENDLFGHISLKKYLDEGYNIIEF
Download sequence
Identical sequences F8AKU6
WP_013867742.1.9613 gi|336122571|ref|YP_004577346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]