SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336121379|ref|YP_004576154.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121379|ref|YP_004576154.1|
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-33
Family GHMP Kinase, N-terminal domain 0.0000089
Further Details:      
 
Domain Number 2 Region: 172-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.43e-33
Family Homoserine kinase 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121379|ref|YP_004576154.1|
Sequence length 307
Comment Homoserine kinase [Methanothermococcus okinawensis IH1]
Sequence
MKMVKVCSPGTSANLGPGYDVFGLALYEPYDTITVMKTDDSNDNDNKITITMEGEKCEEI
PTDVDKNTAGVVAKKMMEDFDISDNIHIHIEKGIKPGSGLGSSSASCAGIAVAMNELFDL
KLSKLELTQYASLGEAVAAGAPHADNVAPAIFGGFTMVVGYEPLEILHTPVEFEVLVALP
NIQIPTKEARELVPKNIPIKDMVNNVGKACGMVYALHTNNIELFGKYMMHDAVVEPCRAP
LIEGYSEVKEKVKDLVYGITISGSGPAIISLPKKEHILEVKKIFKETWNCPIYYTKVGPG
AYVLESK
Download sequence
Identical sequences F8AKP3
gi|336121379|ref|YP_004576154.1| WP_013866562.1.9613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]