SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470185547|ref|YP_007612919.1| from Sinorhizobium meliloti 2011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470185547|ref|YP_007612919.1|
Domain Number 1 Region: 45-263
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.24e-25
Family Phosphate binding protein-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470185547|ref|YP_007612919.1|
Sequence length 288
Comment Hypothetical protein SM2011_b20175 [Sinorhizobium meliloti 2011]
Sequence
MRSRKLKRLVSVTSSLLAAAGALMAAAGSQQAAAQTSDLVSKTAFRVCADPANLPMSDRS
GKGYENRIAELMASKLGLPVEYTWFPMATGFVRKTLQANACDVVIGFAQGDELVLNTNHY
YTSSYVLIVAPEGPLGGVTTLADPLLKDKRIGIVAGTPPATHMARNGLLPKAKGYHLMVD
RRYEDPADDMLADLESGALDAAILWGPIGGPLVKASHPKLKATPLLSETTPPKLFYRITM
GVRQGEKVWERKLNSLIRRNQSEINAILADAGVPLLNDMGTGPLEAQQ
Download sequence
Identical sequences Q92WY7
gi|195970067|ref|NP_436715.2| 266834.SM_b20175 gi|470185547|ref|YP_007612919.1| NP_436715.2.96377 WP_010975086.1.4234 WP_010975086.1.787 gi|195970067|ref|NP_436715.2|NC_003078 gi|470185547|ref|YP_007612919.1|NC_020560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]