SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470186482|ref|YP_007613854.1| from Sinorhizobium meliloti 2011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470186482|ref|YP_007613854.1|
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.51e-58
Family Phosphate binding protein-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470186482|ref|YP_007613854.1|
Sequence length 248
Comment Putative amino acid uptake ABC transporter periplasmic solute-binding protein precursor [Sinorhizobium meliloti 2011]
Sequence
MKKLMIALAVAVLASGGASAADLGGKLLKVGSDTTSPPMESVDPATGQIVGFDIDVVNAI
CAKINCQAEFVTTGWDGIFAALDQGNFDLVASGVSITEERKKAMDFSDPYIVNSQAVLMR
VEDQGVSLEDFKSKGKKLSAQANTTDAQVAEGVVGKENVVAYDSFSAAIIALKNKDVDGV
VINGANAAAYEREFVGELVVAIRDLESDPLGLVFRKGDANVAAFNEGLKMIRDDGTLDQL
VNKYWGVK
Download sequence
Identical sequences A0A222HES7 F7XK01 Q926F7
266834.SM_b20976 gi|16264849|ref|NP_437641.1| gi|16264849|ref|NP_437641.1|NC_003078 gi|384538746|ref|YP_005722830.1|NC_017326 gi|433610742|ref|YP_007194203.1|NC_019849 gi|470186482|ref|YP_007613854.1|NC_020560 NP_437641.1.96377 WP_010975935.1.22199 WP_010975935.1.30341 WP_010975935.1.36091 WP_010975935.1.36292 WP_010975935.1.4234 WP_010975935.1.44594 WP_010975935.1.48083 WP_010975935.1.50755 WP_010975935.1.58608 WP_010975935.1.63001 WP_010975935.1.66997 WP_010975935.1.72343 WP_010975935.1.73540 WP_010975935.1.78492 WP_010975935.1.787 WP_010975935.1.83096 WP_010975935.1.86220 WP_010975935.1.92524 WP_010975935.1.99158 gi|384538746|ref|YP_005722830.1| gi|470186482|ref|YP_007613854.1| gi|433610742|ref|YP_007194203.1| gi|334320532|ref|YP_004557161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]