SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hanva1_1|7931|estExt_Genemark1.C_740001 from Hanseniaspora valbyensis NRRL Y-1626 v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hanva1_1|7931|estExt_Genemark1.C_740001
Domain Number 1 Region: 64-175
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.74e-30
Family Frataxin-like 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hanva1_1|7931|estExt_Genemark1.C_740001
Sequence length 183
Sequence
MFAKIAFLNRNIISGNAFNSLKLVTKTNNIRQFSNINNKLLLQKSFIASNKISSNTYGEK
IPDNIINLTQELYDKKADSFLIELNDSLEEISEIDQDFIKNIDSNQGVLQFEIENVGTYV
INKQPPNKQIWLSSPISGPFRFDYDSLINDWVSLRDHGETKLLNLLNKEISDASNNKYKL
ELL
Download sequence
Identical sequences A0A1B7T9Y0
jgi|Hanva1_1|7931|estExt_Genemark1.C_740001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]