SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357404634|ref|YP_004916558.1| from Methylomicrobium alcaliphilum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357404634|ref|YP_004916558.1|
Domain Number 1 Region: 632-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 2-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0029
Further Details:      
 
Domain Number 3 Region: 501-640
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.21e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0083
Further Details:      
 
Domain Number 4 Region: 150-307
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.88e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|357404634|ref|YP_004916558.1|
Domain Number - Region: 345-391
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0043
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357404634|ref|YP_004916558.1|
Sequence length 851
Comment nitrite reductase [NAD(P)H] large subunit [Methylomicrobium alcaliphilum 20Z]
Sequence
MSKKQTLVVIGNGMVGQNFLAGLASSGAKEHFEIVVFCEEPRPAYDRVHLSAFFSGKTAQ
DLSMVEEGFFEQHGITVHLGDRAKSIDRSAKTVLSENGVRIAYDKIVLATGSYPFVPPVP
GHERDRCLVYRTIEDLEAIETAAEQSKVGVVVGGGLLGLEAAKALKDLGLTTHVVEFAPR
LMAVQLDDGGGALLKRKIEALGVTVHLNKNTTLIDDGESCLHKMNFAGGDALETDLILFS
AGIRPRDDIARDCELEVGPRGGIVIDNQCRTSDPDIFAIGECALWNNRIFGLVAPGYAMA
RTVVSVLEGGDNYFTGADMSTKLKLMGVDVASIGDAHAQTPGALVYTYQNGDSEVYKRLV
VSADKKRLLGAVLVGDASGYGTLLQYCLNGIELPENPDSLILPHRSDESVGLGPDALPMS
AQICSCHDVDKATLCSAIEAGCNTVSALKSETKAGTGCGGCVPLMKSVMECELAKLGIEV
STDICEHFPHTRQELYHLIMVEEIKTFDELIEKHGRGRGCEVCKQAVGSILASYWNDYIL
KKEHIGLQDTNDIFLANMQKDGTYSVVPRVTGGEIQPDKLIVLGQVAKKYGLYTKITGGQ
RVDLFGARVEQLPSIWRELIDAGFESGHAYGKSLRTVKSCVGSTWCRFGVDDSVGLAIEL
ENRYKGLRAPHKIKFAVSGCTRECAEAQSKDIGVIATEGGWNLYVCGNGGMKPRHGDLFA
TQLDKETLIKYIDRVLIFYVRTADRMQRTSVWMENMEGGLDYLRSVVIEDSLSIGEALEK
QMRHVIDTYQCEWKTTIEDESKLKRFRHFVNSDRPDDNIVFVEERGQVRPADEQEREALK
ARKHFKILEEA
Download sequence
Identical sequences G4SVJ2
WP_014147762.1.988 gi|357404634|ref|YP_004916558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]