SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357406612|ref|YP_004918536.1| from Methylomicrobium alcaliphilum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357406612|ref|YP_004918536.1|
Domain Number 1 Region: 120-275
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 409-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00084
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.45e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.029
Further Details:      
 
Domain Number 4 Region: 252-276,314-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357406612|ref|YP_004918536.1|
Sequence length 550
Comment sulfite/nitrite reductase [Methylomicrobium alcaliphilum 20Z]
Sequence
MYQYTQDDQTLIDERVAQFRGQTERFLKGELDGDQFRALRLMNGLYIQTHAPMLRVAGPY
GLLSSRQLRKLAEIARKYDKGYCHFTTRQNIQYNWPKLEEVPDILAELAEVQMHAIQTSG
NCMRNTTTDPLSGVCKDEIEDPRPYCEIIRQWTTLHPEFAFLPRKFKIAVSGALHDRAAT
QFHDIGLHLVKNDAGEIGFKVFVGGGLGRTPVIGQVIRPFLEKKHLLSYLEAIVRIYNLF
GRRDNKYKARIKILVKEEGLEKITELVEQEWQLNKDSLELSDERIESIKAQFAPPAYETD
ADLDGSFNDRLQDNPTFATWVQQNTADHRVPGYRAAFISLKAPDAPPGDITDAQLDLVAD
LADRFSFGEVRSTHRQNLVLTDVKQTDLFTLWQALDAANLATPNIGSATDIICCPGLDFC
SLANAGSIGITREINHALDDLDYLHDLGDIKINISGCMNGCAHQSVGHIGILGVDKKGEE
WYQITLGGSSENDAAIGERLGPAVAKDQITRAVQDILDVYIKQRQEGESFLHTVKRVGIT
PFKEQVYANH
Download sequence
Identical sequences G4T4E2
gi|357406612|ref|YP_004918536.1| WP_014149710.1.988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]