SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357407121|ref|YP_004919045.1| from Methylomicrobium alcaliphilum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357407121|ref|YP_004919045.1|
Domain Number 1 Region: 145-342
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000539
Further Details:      
 
Domain Number 2 Region: 427-556
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000756
Further Details:      
 
Domain Number 3 Region: 8-144
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.26e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 
Domain Number 4 Region: 344-419
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.28e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357407121|ref|YP_004919045.1|
Sequence length 568
Comment sulfite reductase subunit beta, NAD(P)-binding, heme-binding [Methylomicrobium alcaliphilum 20Z]
Sequence
MTDVSEEELNKRVEVERIKDASNYLRGSLVESLNNPLTGALTDSDTQLSKFHGIYQQDDR
DLRDERRKQKLEPHYQFMVRVRVAGGICTPAQWLEMDRIATTWCNNSIRLTTRQALQFHG
ILKRDLKRSIAEINASLLDTIAACGDVNRNVMCSPVPEQSRLHGEAYEYARRINDHLTPR
TTAYHEIWLDEKLIDSSRQDEEPIYGKHYLPRKFKTAIAVPPANDVDIFANDLGFIAIAE
NDRLVGFNVTVGGGMSLTHGEPNTYPRLADVIGYCPKHKTLQVAEEIVKIQRDFGDRTNR
KHARLKYTIDDRGVDWFKFELNRRLGWQLEEPREYKFEYTGDRYGWLKGVNDTWDYTVFI
QNGHIADDDAPIMTGLREIAKVHDGDFRISPNQNLIIGKVSDHNKPVIESLLRQYGFIEP
GQQSALRLNAMACVAFPTCGLAMAESERYLPAFLDKLEPLLQRLGLENDPILLRMTGCPN
GCARPFLGEIGLVGKAPGKYNLYLGAGFEGQRLNKLYRENINEEQILTELTPLLQHYADD
RQVGERFGDFVIRNGYVEAMIAGRDFHR
Download sequence
Identical sequences G4SZ05
WP_014150215.1.988 gi|357407121|ref|YP_004919045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]