SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479150374|ref|YP_007780550.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150374|ref|YP_007780550.1|
Domain Number 1 Region: 25-116,250-467
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.45e-89
Family Bacterial dinuclear zinc exopeptidases 0.000000482
Further Details:      
 
Domain Number 2 Region: 118-250
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 6.96e-32
Family Aminopeptidase/glucanase lid domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479150374|ref|YP_007780550.1|
Sequence length 470
Comment Aspartyl aminopeptidase [Ruminococcus bromii L2-63]
Sequence
MAEEKSKTTLLKEKIMMTEPKGVKALSEEEIKKADSFCDGYKKFLDNSPVEREAVRYTVE
LAKKAGFAEYEQDKEYKAGDRLYYVNRDKAVALAVIGKNGVKNGARLAIAHIDSPRVDLK
PNPLFEANNLAFFKTHYYGGLKKYQWTTIPLSLHGSVVKLDGTRVDICWGDDENESCFCI
TDLLPHLAREQASKPMAKAIEGENLNVILGSRPYDADSEEKDLVKLNVMAILNEKYGICE
GDFLSAELCLIPSFKSRDIGFDRSMIGGYGHDDKVCAYPAVMAALDVEMPEQTCITYLTD
KEETGSDGNTGMQSDFLRFFIYDLAKQDGVDGYRVLSKSTCLSADVNAAFDPTFASAYEA
NNCSYINNGVIISKYTGHGGKYDTSDASAEYMGKIRAMLENNDILWQVGELGKVDGGGGG
TIAKYVANMNVDVVDLGVPVLSMHAPFEIVSKTDVYMAYRAFFTFFDTKD
Download sequence
Identical sequences D4L578
gi|479150374|ref|YP_007780550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]