SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479151191|ref|YP_007781367.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151191|ref|YP_007781367.1|
Domain Number 1 Region: 8-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-53
Family PP-loop ATPase 0.0000577
Further Details:      
 
Domain Number 2 Region: 335-430
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|479151191|ref|YP_007781367.1|
Domain Number - Region: 210-308
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000418
Family MesJ substrate recognition domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479151191|ref|YP_007781367.1|
Sequence length 442
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain [Ruminococcus bromii L2-63]
Sequence
MLNRVTATVEKYGLLEKGDSVIVALSGGADSTALLSVFVSLKEKYNLSIYAAHINHNIRG
DEATRDENFCKILCKKFNTELFIKSVDVPTLAKQQKISEELCGRNVRYAFFEELSQKLCA
KIATAHTASDNAETLIFNIARGASLTGLSAIPPKRGNIIRPLIELSRGDIESYCEENNLE
YVTDSTNLADDYTRNYIRHNIIPCLKKLNPSFERTALGLSENAGESADFIKECAEKAVHD
CKGDFGYDCKKLLSLDSAVLKEMLFILLKNNCNISPERKTILLLCEIIRNGGSVELSKQR
TAVSKQGILRFVCPKNSPDFNEIPLKNNMTFSYDGKIYTVNEITEKVTNQNNLVSKKRLG
ENPVFRTRRAGDRFTYPDRMVTKPLRKVFNEQKIPSEMRDRLLLLAVSNTVLWCEKLGVS
LQGKADDTEKTEKLLINIDKEG
Download sequence
Identical sequences D4L7J5
gi|479151191|ref|YP_007781367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]