SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479151364|ref|YP_007781540.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151364|ref|YP_007781540.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.12e-17
Family YmcA-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151364|ref|YP_007781540.1|
Sequence length 135
Comment Protein of unknown function (DUF964) [Ruminococcus bromii L2-63]
Sequence
MDIIEKARELGRLIQEEDSYKKLQDAQKNADADMELQRLIGEFNLKRMSINNEASKKERD
QEKLSKLNTEMREAYSQIMSNENMIAYNDAKAAFDVVANRVLAIVQQSAEGADPETADYS
QSSCSGSCATCGGCG
Download sequence
Identical sequences A0A1C6CPC3 A0A1Q6TC59 D4L818 R5E8I6
gi|479151364|ref|YP_007781540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]