SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479151542|ref|YP_007781718.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151542|ref|YP_007781718.1|
Domain Number 1 Region: 1-80,167-335
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.35e-50
Family Bacterial dinuclear zinc exopeptidases 0.0000533
Further Details:      
 
Domain Number 2 Region: 68-172
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.21e-17
Family Aminopeptidase/glucanase lid domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479151542|ref|YP_007781718.1|
Sequence length 342
Comment Cellulase M and related proteins [Ruminococcus bromii L2-63]
Sequence
MNTKELIFELCCAMGVSGREEPALSVAEKFLSDYTDDIKISNGSLMAVCGNKNSDKTILL
DAHIDRIGFMVTEINENGFVKVSPCGGIDARTLADTLLCLQNNPDVTGVVCCMPPHLSDG
KEDKAMPTDKIWVDFGLPYDEVNKLISFGDMLTFASKPANLLNGRIVAPCLDNRCGVASL
VKCTELLKDNETDYKVIILLSSQEETFGTGAKTGAFTVEADESIVVDVSFASQPDVSGFY
SSVELDKGPMICISSILNKEMSKSLESVAKNKNIPYQLEPIAGRTGTNADHISISGKGVK
TAVVSIPQRYMHTQNEVISVADVDNTAKLIAEYIKCGGAFND
Download sequence
Identical sequences D4L8J6
gi|479151542|ref|YP_007781718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]